SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I1G1S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I1G1S5
Domain Number 1 Region: 542-597,658-695,752-825,1479-1597
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.93e-38
Family Ankyrin repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 1138-1185,1298-1368,1411-1523
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000498
Family Ankyrin repeat 0.009
Further Details:      
 
Domain Number 3 Region: 375-450,501-596
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000589
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I1G1S5
Sequence length 1833
Comment (tr|A0A2I1G1S5|A0A2I1G1S5_9GLOM) Ankyrin {ECO:0000313|EMBL:PKY40575.1} OX=588596 OS=Rhizophagus irregularis. GN=RhiirA4_538932 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MASIYVKDQTVAKYLSSFRNNDINGIRASLKEESIYRQMFALKPENINSSQSKLLRQPYL
NLINVYENIDIWKIKNRFFNNEAGNDADDGMYIMPLPEEKRLKHDDPAICLDGNEKFYKN
WRLFTESSLLELDWSNVFAAGGAVLSCLLPIPKEYDDSLRNIRNWYHNIAYQSSDIDLFI
YGLDEEAAKKKMEEIYENICNAIPWEVTCFRSKHCVTIISQYPYRHIQIILRLYNSPSEV
LTGFDVDCCSVGFDGKNVWALPRAHQAIIKQCNVIDLTRRSPSYEMRLAKYTERGFEIKV
HSLERSRIDPTIYEKSFEKLNGLARLLVLERLNTPENRYAYVEKKRERNCRPSHPKSGVY
ESRKWKRKPNINKTKFENNDYETLILPYGISYNVDRITRLIYSKDMALNSMWNKDNKDRV
LHRHICFFGTMKEIFDDCCGHCPEPSTPDEFAAQIEEDKTFIRGKMEFIKDDPGRQTIGS
FHPLTDDDWTSQAYITNVRVDLCSACARGDVDIVESILKSNLNVDEDFQLERVNIEARDY
LGRTPLQLAVLGGHTELVKILLKYDARIIARMSDGKTVVHLASQYGFLDILELLLQKSNE
NKEKAQEQKDVMSLSEMNNRTNIEFDNSFEIIDKSEIERELEDLIFDPIDKENDQDDIID
INTETWDHLLTALDYAIIFGHVEIVKLLVEAGADVQRQIKLQVQNNHNRSFYHNRISAGV
IYYPLGLCLLTQDQKSGLEIASILLKSGASTSQVNHEYNTILHLAAKEGKTQFIKLLLDE
DPNSLQIINSLNSMVESPLSISVLKNYLESTELLLKYGARPYISLEDVQISKKHQNHNEL
LILGRVAQPITHALNNSQYRILIEAGADINTIYNCNCPRTTIENAIALNEWNIKSYKEKL
NAEKEKEPVSNEDEVTIFINSLSDLLEKEKKIDEGTYRGYVLSQHTTKNFYEFLNAKNRQ
LYPWNSILAPNYSVVHEDYSKLLELEIEKLNYNKKCLDYLISRGAKTYKEIEMENKLQEP
KKSMKELQERLNSVRISLEEQAGTLEAEEKERYLKEEILLQHAMNEQQEEIDRICNGYNE
QSSYNSFGQIQNPNLGLLLKTVSSKPLIDFDEFIMKFTYPKNYSDKIPAELIPEYVKLFQ
AVYDNDISKVEEMSQKLVFAVCDKCNMTPFMWACFRGHNELAIKILDIVTSQYEPKKNIE
LINEGNNTNVINNYDIIDDDDDGESENNYSDGFGYEHQGPLQSTSEDNDSKSLNFKPVSN
CLAHVFLMHQGNFASKNVLPKEFLKESEIVDNIFLNGLEVAVFKNNLEMVKKILDWAEKY
QHANGDYFKNNGGLVTSLIQGNNARNPMTDSIYLGYVDMMDILIEYAAGGNDFFVFDIKD
PEETPVPEKSNYYQGLNINGRKKKSWIIRYNPNYSNKSVKPPYLFYAAYYGNIASIRYFF
SERPIKALEKFAQKYADNKSKDLRVTILDTIKNIQKVGRKLFNYELFRNETPFHWAVQNN
EHDIIKELIRLYKEQESKEQKGYDGEKPLTLEELLDMRADEKKITALLLAAQFGFNECIK
ALLEGGADPGITDCNGWSLAHYVVDNDKDETLRLLQELLQTETYQRMLEQRSKSFNHTPL
SISILNYNEKMTEYLLQQVTDKNLFTYDFENNRYLHLSLREGLWCISKKLIEAEESIITA
EDNERFCSLYHENSFGQTPTDIAIQMYLNSLFSLQQSTTGYQYQYHHNQYKVVEKCATKS
FNFMVPKYLPRNQGNPLAIRVNVKFDAVNDMVHKLTKKITDGNIHYNHYNTGITSKEQNT
KSHLNIPMFSFKQFKQPSTLSSHYQFSSTHVNV
Download sequence
Identical sequences A0A2I1G1S5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]