SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I1GTC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I1GTC0
Domain Number 1 Region: 9-115
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.48e-17
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 222-284
Classification Level Classification E-value
Superfamily HMG-box 0.00000000838
Family HMG-box 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I1GTC0
Sequence length 300
Comment (tr|A0A2I1GTC0|A0A2I1GTC0_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:PKY49891.1} OX=588596 OS=Rhizophagus irregularis. GN=RhiirA4_253243 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
DASNSSEKLFGIIPFIDPEKFGGCSQNYKLNEKSDVYSAGVLLWVISSGQYPFNNRKYDI
NLAIEISKGLRETPITQTPDEFLKIYTKCWNGKPTERPTMQQVVAKLKAIITKTNGTNGT
NGITEYSQVEDSSSNVIANSVTSAATSSINNSLHGELSGIIENFGNMELESNNNNSSVSS
NISTIEKVVKILSTVNDADGVINITVPFPPQITAEEILDRNKTKERKKVPNKFMIYRMAY
AKELKTQNISNINSFNISVLAASRWSSEPDEVKQAYKDISNRVRQLEIIRNSIDSNTVNT
Download sequence
Identical sequences A0A2I1GTC0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]