SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I1HB62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I1HB62
Domain Number 1 Region: 159-224
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.69e-21
Family DNA-binding domain from rap30 0.0013
Further Details:      
 
Domain Number 2 Region: 8-66
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.000000288
Family Rap30/74 interaction domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I1HB62
Sequence length 272
Comment (tr|A0A2I1HB62|A0A2I1HB62_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:PKY56123.1} OX=588596 OS=Rhizophagus irregularis. GN=RhiirA4_506499 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MEIDYENVGDDIDLKDLENEAWLIKLPAYLFDKWADVADDDTELARVQFFVDSRGIELLV
DDNVADTYLFYQYKDDGSVSMAATAKKNFIVKPTFGVDYSRKVRQRTLQAATSMRGIKII
GDNENHGTYVPPGAYAAAITKFGNLVQKKPKVSINQKTTRMPKNELIDLLFGAFEKYTYW
TLRGLKDYAKQPESYLKDVLNEIAILDKRGSYNNYYHLKPEYSKQSSNASDIAPLGLEAP
AIGTVDDDFEFENDNDIEYKLESDDENLFEDD
Download sequence
Identical sequences A0A2I1HB62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]