SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2BR77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2BR77
Domain Number 1 Region: 6-73
Classification Level Classification E-value
Superfamily Homeodomain-like 2.05e-17
Family Tetracyclin repressor-like, N-terminal domain 0.006
Further Details:      
 
Weak hits

Sequence:  A0A2I2BR77
Domain Number - Region: 148-182
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0133
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2BR77
Sequence length 197
Comment (tr|A0A2I2BR77|A0A2I2BR77_9LACO) TetR/AcrR family transcriptional regulator {ECO:0000313|EMBL:PLA94143.1} OX=1624 OS=Lactobacillus salivarius. GN=CYR84_03820 OC=Lactobacillus.
Sequence
MHQNDLRVRKTRAKIKKALIETINEKGFGNLTVSDITERAGINRGTFYIHYKGKQDLLNQ
LEENIYADIIKLFHENGTISSATSYEDLNEQFFQKFSAYIYGERDFILAMVLGNGDPMFY
HKVKQILIRELLKRMDYLGIKMDDEIPREYIQEYAIGSMLNLSIYWLEKDDPESPSEFTK
IMMHTRTKAPLSFAVKE
Download sequence
Identical sequences A0A2I2BR77 F5VDL8
WP_003705580.1.90376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]