SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2FRI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2FRI0
Domain Number 1 Region: 391-551
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000441
Family Extended AAA-ATPase domain 0.075
Further Details:      
 
Domain Number 2 Region: 823-878,945-1058,1150-1168
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000851
Family Ankyrin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 1060-1202
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000536
Family Pseudo ankyrin repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2FRI0
Sequence length 1540
Comment (tr|A0A2I2FRI0|A0A2I2FRI0_9EURO) Uncharacterized protein {ECO:0000313|EMBL:PLB43244.1} OX=1392250 OS=Aspergillus steynii IBT 23096. GN=P170DRAFT_419109 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MFLRLCAKLNFTKADRDGRKKHDDQPPPPSTTDQDRVGTKANNGVPSRRDAETDNTPREN
LCEVTGERLDENPPPSSTTVQDHTGKKADTGVPSTRDVKPDLPRENLWEVAGERLDEEHR
NALGLESVFPVTNAIEQVIKTTEEKYREYKEGGLKIRKRDGGHINVRDSAKNIILYTLQA
QDIVKKLVAFDPTGHASSAWSIVSIGLTLIKNDIERRDDIFETAEYLARILSYYAIVDNH
YRERKVESDRGLEDALIEVYLAILQYTAEVKKAEKESHAARVVKSITALVHQPLKDLKET
VEQKGQAVQNWTNLTAALDHRKQAETMLDGIDEAVERLKIIQSHTRSLQDREILDWLSTA
SYSDPQIHTQDRRASNTGNWFLDLPEYKEWKATPGQICWLYGAVGCGKSVLCSTVIQDIG
EFCRPDSSRHFAYWYFQFSNDETQKVYNMIRSILRQFMPRELPASMVKLWEEHRHRGSEP
QQQKLVEILDIVLETSQGEFFLILDALDECPTTGHNERRSLLPFLEELLGKHRSKMHILA
TSRPEPDIRSRLEQYQSVDLETGLGGDVETFVRAQVAGGRLCQWDESIKKLTLEKLLDIP
ERRRFRWADLQIERLEESTDEDEFHEALDSIPATLEDTYKDTLERLSPKHRKAARTILMW
LSFSAVPLDLKTVAAAVSFRFPGDVVTTCTTSLVTVSISDNTVRLAHFSVKEFLVCNEPE
VQWYQFSALSGHNAIANKTIDCLLETTEILTKTTAVQKPLQIYAAGYWDRHLAELGDLHA
SRTGLQEKIDLLFTERDIYFNWVRLVDFDCDYKWHQSFEELEPPLVIASGKGLKQTVEML
LAKGVNSMGPHPGLYDALLAAAGQGYLEVLELLLNKVDEIPRRVIGNMLWHIKTAEADKE
KLAIILDLLSDKGALHDQSRASHRIIDERLVERAAGNMWSGQILMGLFLDRQEKMGVKIT
EGLLNAVLHNYYYSEEIMHMLLKSCDVDIKLTPSLMQVLGSSYNTNAMTAVLSRRINDVT
LDEECVGAFASGNKEAMELLLRERGEEIQVTQKVLITAASSARDPQTVKLLLNRREPGID
IGKEVLLAAAGNWTIGSEIMEMLLDERGQDTVINDEIIQEIADNRDQGLGMMKTLLRRQQ
AGFVVTEQTLCNAARCHSREMLELLVNNSGGSDLPITGKILCSVAGNIARGNALMEYLFD
LRGHSLPVSEDVLVSVADVKFLAAKSPAADEVLTFILERWPEIPATDRLLEAACGHPKAM
GLLLDRQQDCLPIERMIYKIATDWRGGRVLEMLLDRQLVQVDEWLVETVAGNDGALEVIY
SRNPDFPVTPKAVVNAARKSDAMRILLNRQKNQVLITEEVIKASLLGSHPESVISLLLAR
LGPEAVPITEDILIYAIRNNQFSSVELFLEQRRGLNLSTVWETIWQDPEIPPSSLAKAGG
ALVQHASFDVSDKMLERIPSEFLDSFIRACMQHRISLPTTEAAFELIVERSSLNTVDIFL
EDHPGFPITERHIEAAGRNQTKYIDNDALGSLLSAKSSSS
Download sequence
Identical sequences A0A2I2FRI0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]