SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2UEJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2UEJ7
Domain Number 1 Region: 367-545
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-32
Family Nucleotide and nucleoside kinases 0.00000137
Further Details:      
 
Domain Number 2 Region: 130-318
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.91e-32
Family Nucleotide and nucleoside kinases 0.0000421
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000628
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2UEJ7
Sequence length 547
Comment (tr|A0A2I2UEJ7|A0A2I2UEJ7_FELCA) Adenylate kinase 5 {ECO:0000313|Ensembl:ENSFCAP00000030905} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=AK5 OC=Felinae; Felis.
Sequence
MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLKKVKELGGCDKVKWDTFV
SQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIE
EYDVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKW
SLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDLV
VFLACANQRLKERLLKRAEQQGRPDDNLKATQRRLMNFKQNAAPLIKYFQEKGLIMTFDA
DRNEDEVFYDISVAVDSKLFPNKEAAAGSGDLDPSMMLDTGETIDTGSDYEDQGDDQLNV
FGEDTMGGGPGSGKGTQCEKLVEKYGFTHLSTGELLRNELSSESERSKLIRDIMERGDLV
PSRIILELLKEAMLASLSDTKGFLIDGYPQEVKQGEEFGRRIGDPHLVICMDCSADTMTN
RLLQRNQSSPLVENNTTTIAKRLETYYRASIPVIAYYEMKTQLHKVNAEGTPEEVFLQLC
TAIDSIF
Download sequence
Identical sequences A0A2I2UEJ7
XP_019692825.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]