SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2UJH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2UJH2
Domain Number 1 Region: 9-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0046
Further Details:      
 
Domain Number 2 Region: 69-119
Classification Level Classification E-value
Superfamily EF-hand 0.000000848
Family Calmodulin-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2UJH2
Sequence length 132
Comment (tr|A0A2I2UJH2|A0A2I2UJH2_FELCA) EF-hand calcium binding domain 10 {ECO:0000313|Ensembl:ENSFCAP00000032615} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=EFCAB10 OC=Felinae; Felis.
Sequence
MQARGSREQEARDYLEKHRIMELLNYLTSTLLFFRPEKPREYLISVLERLRIAKMTGLAF
PFFMDHSNIVSMFEMMDTSNKGTISFVQYREALKTLGLLTADEVLKDDGHAVTLDKFRRE
VNKRMEEIWAAF
Download sequence
Identical sequences A0A2I2UJH2
XP_006929191.2.62641 XP_007084001.1.5354 XP_019306763.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]