SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2UT89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2UT89
Domain Number 1 Region: 32-72
Classification Level Classification E-value
Superfamily CCHHC domain 2.88e-16
Family CCHHC domain 0.00097
Further Details:      
 
Domain Number 2 Region: 85-107
Classification Level Classification E-value
Superfamily CCHHC domain 0.00000000131
Family CCHHC domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2UT89
Sequence length 108
Comment (tr|A0A2I2UT89|A0A2I2UT89_FELCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSFCAP00000035548} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN= OC=Felinae; Felis.
Sequence
LCPFFSLSGCPRAKKSGIRVAQSKEDKEDQEPIRCPVPGCDGQGHITGKYASHRSASGCP
LAAKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVSGSFLTHRR
Download sequence
Identical sequences A0A2I2UT89

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]