SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2YCZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2YCZ0
Domain Number 1 Region: 68-118
Classification Level Classification E-value
Superfamily EF-hand 0.000000349
Family Polcalcin 0.064
Further Details:      
 
Domain Number 2 Region: 10-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000235
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2YCZ0
Sequence length 129
Comment (tr|A0A2I2YCZ0|A0A2I2YCZ0_GORGO) EF-hand calcium binding domain 10 {ECO:0000313|Ensembl:ENSGGOP00000032771} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=EFCAB10 OC=Catarrhini; Hominidae; Gorilla.
Sequence
METSSRELQAAEYLEKHHIKELVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFP
FFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLSTEDEDLQDDGHKITLDKFKEEV
QPSLKTGFL
Download sequence
Identical sequences A0A2I2YCZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]