SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3G4B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3G4B5
Domain Number 1 Region: 68-118
Classification Level Classification E-value
Superfamily EF-hand 0.00000155
Family Polcalcin 0.046
Further Details:      
 
Domain Number 2 Region: 10-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000248
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3G4B5
Sequence length 131
Comment (tr|A0A2I3G4B5|A0A2I3G4B5_NOMLE) EF-hand calcium binding domain 10 {ECO:0000313|Ensembl:ENSNLEP00000026862} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=EFCAB10 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
METSSRELQAAEYLEKHRIKELVSYLTSALLFFRPEKPREYLISLLERLRIAKVTGVAFP
FFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDEDLQDDGHIITLDKFKEEV
NKRMKEIWSAF
Download sequence
Identical sequences A0A2I3G4B5
XP_012367786.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]