SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3H3N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3H3N5
Domain Number 1 Region: 25-54
Classification Level Classification E-value
Superfamily Defensin-like 0.0000254
Family Defensin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3H3N5
Sequence length 59
Comment (tr|A0A2I3H3N5|A0A2I3H3N5_NOMLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSNLEP00000038100} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN= OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
VRIHYLLFALLFLFLVPVPCHGGLMNTLQKYYCRVRGGWCAVLSCLPKEEQIGKYSIKK
Download sequence
Identical sequences A0A2I3H3N5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]