SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3HQ88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3HQ88
Domain Number 1 Region: 47-314
Classification Level Classification E-value
Superfamily L domain-like 2.55e-57
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 230-477
Classification Level Classification E-value
Superfamily RNI-like 4.24e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.017
Further Details:      
 
Domain Number 3 Region: 547-848
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.5e-33
Family Rhodopsin-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3HQ88
Sequence length 907
Comment (tr|A0A2I3HQ88|A0A2I3HQ88_NOMLE) Leucine rich repeat containing G protein-coupled receptor 5 {ECO:0000313|Ensembl:ENSNLEP00000045778} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=LGR5 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MDTSRLGVLLSLLVLLQLAAGGSSPRSGALLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLM
LQNNQLRQVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQ
AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD
LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA
FQHLPELRTLTLNGASQITEFPDLTETANLESLTLTGAQISSLPQTVCNQLPNLQVLDLS
YNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPSAFST
LPSLIKLDLSSNLLSSFPVTGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENAYKISNQWNKGDNSSMDDFHKKDAGMFQVQDERDLEDFLLDFEEDLKALHSVQ
CSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTSTVFRSPLYISAIKLLIGVIA
AVNMLTGVSSAVLAGVDAFTFGSFARHGAWWENGVGCQVIGFLSIFASESSVFLLTLAAL
ERGFSVKCSAKFETKAPFSSLKVIILLCALLALTMAAVPLLGGSEYGASPLCLPLPFGEP
STTGYMVALILLNSLCFLMMTIAYTKLYCNLDKGDLENIWDCSMVKHIALLLFTNCILYC
PVAFLSFSSLLNLTFISPEVIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLGKQTYF
WTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSIAYDLPPSSVPSPAYPVTENCHLSS
VAFVPCL
Download sequence
Identical sequences A0A2I3HQ88
ENSNLEP00000005285 XP_003259592.1.23891 ENSNLEP00000005285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]