SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3MHW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3MHW9
Domain Number 1 Region: 23-79
Classification Level Classification E-value
Superfamily L27 domain 8.63e-23
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3MHW9
Sequence length 101
Comment (tr|A0A2I3MHW9|A0A2I3MHW9_PAPAN) Lin-7 homolog A, crumbs cell polarity complex component {ECO:0000313|Ensembl:ENSPANP00000035309} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=LIN7A OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSE
FCTAIREVYQYMHETITVNGCPEFRARATAKVFSCVHCKRI
Download sequence
Identical sequences A0A1D5Q3S0 A0A2I2ZJW4 A0A2I3MHW9 A0A2I3RDE4 A0A2J8SI25 A0A2K5EAX6 A0A2K5HHY4 A0A2K5LER4 A0A2K5RRC3 A0A2K5X041 A0A2K5XMG6 A0A2K6DH26 A0A2K6JYI9 A0A2K6Q0G2 A0A2K6U5Q1 J3KN23
ENSP00000261203 ENSP00000261203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]