SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3MWU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3MWU4
Domain Number 1 Region: 39-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.95e-88
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000392
Further Details:      
 
Domain Number 2 Region: 285-490
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.7e-44
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00016
Further Details:      
 
Domain Number 3 Region: 620-796
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 8.5e-34
Family AlaX-like 0.046
Further Details:      
 
Domain Number 4 Region: 545-620
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000459
Family AlaX-M N-terminal domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3MWU4
Sequence length 985
Comment (tr|A0A2I3MWU4|A0A2I3MWU4_PAPAN) Alanyl-tRNA synthetase 2, mitochondrial {ECO:0000313|Ensembl:ENSPANP00000040076} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=AARS OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAASLAAAARRLRRAIRRSPAWRGPSHRPLSSEPPAAKASAVRAAFLNFFRDRHGHRLVP
SASVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHNDLED
VGRDLSHHTFFEMLGNWAFGGEYFKEEACSMAWELLTQVYGIPTERLWVSYFDGDPKAGL
EPDLETRDIWLSLGVPATRVLSFGPQENFWEMGNTGPCGPCTEIHYDLAGGVGAPQLVEL
WNLVFMQHNREADGSLQPLPQWHVDTGMGLERLVAVLQGKHSTYDTDLFSPLLHAIQQGC
RAPPYLGRVGVADEGRTDTAYRVVADHIRTLSVCISDGVFPGMSGPPLVLRRILRRAVRF
SMEILKAPPGFLGSLVPVVVETLGDAYPELQRNSAQISNLVLEDEAAFLASLERGRRIID
RTLRTLGPSDMFPAEVAWSLSLSGDLGLPLDMVELMLEEKGVQLDSTGLERLAQEAAQHQ
ARQAKPVQKQGLWLDVHALGELQRQGVPPTDSSPKYNYSLRPNGSYEFGTCEAQVLQLYT
EDGTAVASVGKGQRCGLLLDRTNFYAEQGGQASDRGYLVRVGQEDVLFPVARAQVCGGFI
LHEAVAPECLQIGDQVQLHVDKAWRLACMAKHTATHLLNWALRQTLGPGTEQQGSHLNPE
QLRLDVTTQTALTPEQLRAVENTVQEAVQQDKPVYMEEVPLALTAQVPGLRCLDEVYPDP
VRVVSVGVPVAHALDPASQAALQTSVELCCGTHLLRTGAVGDLVIIGDRQLSKGTTRLLA
ITGEQAQQARELGQNLAQEVKAATERLSQGSRDVAEALRLSKDIGRLIEAVDTSVMPQWQ
RRELLATLKMLQRRANTAIRKLQMGQAAKKTQELLERHSKGPLIVDTVSAESLSVLVKVV
RQLCEQAPSTSVLLLSPQSMGKVLCACQVAQGAMPTFTAESWALAVCSHMGGKAWGSRVV
AQGTGSTTDLEAALSTARAYALSQL
Download sequence
Identical sequences A0A2I3MWU4
ENSPANP00000012824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]