SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3S611 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3S611
Domain Number 1 Region: 94-133
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3S611
Sequence length 518
Comment (tr|A0A2I3S611|A0A2I3S611_PANTR) Chromosome 8 C8orf34 homolog {ECO:0000313|Ensembl:ENSPTRP00000072474} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=C8H8orf34 OC=Catarrhini; Hominidae; Pan.
Sequence
MSSPLASELSELAALRPGFRLSAPHARVSPRAATHARGRGRASHAGQPRIRSSCPGPSPG
KRRVVPSGGAQPRVLPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETP
DQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRSYDKPWQLNAKK
PKKSKSDLAVSNISPPSPDSKSLPRSVEHPKWNWRTKPQSRDFDELNHILQESKKLGKAL
ENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQ
WESEDSGSSPAGSLKMEPKNKGLKQQQQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDN
EDDAMELLEDLNDLRMEGVTTLVPSGSKFNQGRPTYPAEPQAKVTLNICSRCARLQGDNL
EERTEESLPILHSPDEKIPDSFDSLPGTEEALMEEGDGFEKASKLTGPGEASSGVGHSLK
NYMEEDESLKQLQVIHQPWILPSDTESEGVEAEQEKRL
Download sequence
Identical sequences A0A2I3S611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]