SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3TDP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3TDP9
Domain Number 1 Region: 502-532
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3TDP9
Sequence length 536
Comment (tr|A0A2I3TDP9|A0A2I3TDP9_PANTR) Chromosome 3 open reading frame 30 {ECO:0000313|Ensembl:ENSPTRP00000087383} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=C3orf30 OC=Catarrhini; Hominidae; Pan.
Sequence
MEEPPQEALAEPLKHESPGAPSSAGHTKGQEEDDQKNQAERKADNHTAHRIADQTALRVP
SQAESSIFSQATNGVAEQNGHSTPGQAGRRASNPADVSDLRADDQVNQTPSEQTKGKASS
QANNVQHEQSDGQVSGLTEERTAEQTERRLPSQAERRTSGQIDGRLAMPSDQRGSRQTDH
RMAGQSERRASEQTDRRMSGEAERRNSEQITHRLSKLSERRPSVQIDSGSSVPSDRSPSV
QIDSGSSVPSDQRPSIQIDRRMSGKVRRRSSEKTDYRLAGLADPGTSEQTDLRLYGLVDH
KTSVKTHHQVYGQATELAEHQAIDQAHSNADQPPVDNAHYTESDQTDHLADRQANHKDQL
SYYETRGQSEDRTFPQLGNSKEDKEADYRVQPCKFEDSQVDLNSKPSVEMETQNATTIPA
YNPVDARFTSNFQAKDQALFPRLPSISSKLNYTSSQEKTQAIVTKSDEFSEIEQGKGYHI
RNQTYRRFPSIVYEDPYQVSLQYMEKHHILQIFQQITENLVYEKPEDPLNFMLCQV
Download sequence
Identical sequences A0A2I3TDP9
XP_016797184.1.37143 9598.ENSPTRP00000026296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]