SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3TN03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3TN03
Domain Number 1 Region: 91-123
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000129
Family GLA-domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3TN03
Sequence length 128
Comment (tr|A0A2I3TN03|A0A2I3TN03_PANTR) Matrix Gla protein {ECO:0000256|RuleBase:RU361261} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=MGP OC=Catarrhini; Hominidae; Pan.
Sequence
MKSLILLAILAALAVVTLCYGEWQKEENFCFDIVSVHSLNWHRAQESHESMESYELNPFI
NRRHANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAMVYGYNAAYNRY
FRKRRGAK
Download sequence
Identical sequences A0A2I3TN03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]