SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4AKH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4AKH9
Domain Number 1 Region: 94-198
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-29
Family PDZ domain 0.0000351
Further Details:      
 
Domain Number 2 Region: 12-44
Classification Level Classification E-value
Superfamily L27 domain 0.0000000101
Family L27 domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I4AKH9
Sequence length 228
Comment (tr|A0A2I4AKH9|A0A2I4AKH9_9TELE) disks large homolog 4-like {ECO:0000313|RefSeq:XP_013855999.1} KW=Complete proteome OX=52670 OS=Austrofundulus limnaeus. GN=LOC106511811 OC=Austrofundulus.
Sequence
MEACQADASDGVKGRAEKLLNIFQSDLFQALLDIQEFYELTVCENQTPSRPHTPAQKYRY
QDDETPPIDPSPGHMSQRRSAELIHTHLDGYTHPAALTMNGSEGELEYEEITLERGNSGL
GFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSIVFVNDVDVREVTHSFAVE
ALKEAGPVVRLYVLRRRPPTERMTQIKLLKGPKGLGFSIAGGVGNQHV
Download sequence
Identical sequences A0A2I4AKH9
XP_013855999.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]