SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4ANX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4ANX2
Domain Number 1 Region: 248-386
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.19e-35
Family cAMP-binding domain 0.00000195
Further Details:      
 
Domain Number 2 Region: 117-244
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.27e-30
Family cAMP-binding domain 0.0000015
Further Details:      
 
Domain Number 3 Region: 4-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000183
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I4ANX2
Sequence length 393
Comment (tr|A0A2I4ANX2|A0A2I4ANX2_9TELE) cAMP-dependent protein kinase type II-alpha regulatory subunit {ECO:0000313|RefSeq:XP_013857204.1} KW=Complete proteome OX=52670 OS=Austrofundulus limnaeus. GN=prkar2a OC=Austrofundulus.
Sequence
MAMEFQIPKGLTELLQGYTVEVLRQRPSDLVDFAVQYFTRLRDSRSQDGSSPGGKPGKGV
MFDGEPMQTESNGEDDEDDDSDFEPPPPSRFNRRVSVCAETINPDEDDEDTEPRVVHPKT
DEQRCRLQEACRDILLFKTLDQEQFSQVLDAMFESKVQPQEHVIDQGDDGDNFYVIERGV
FDIVVSGNCVGQYNNKGSFGELALMYNTPRAATIVATQEGALWGLDRATFRRLIVKNNAK
KRRMYECFIESVPLLKSLEVTERMKLVDVLGAKQFSDGERIITQGDKADCFYIVESGEVK
IMMKSKTKADHADNAEVEITRCSRGQYFGELALVTNKPRAASAYAVGDVKCLVIDVQAFE
RLLGSCKEIMKRNIAHYEEQLVALFGSSMDLRD
Download sequence
Identical sequences A0A2I4ANX2
XP_013857204.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]