SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4BL68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4BL68
Domain Number 1 Region: 130-312
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-32
Family Nucleotide and nucleoside kinases 0.0000489
Further Details:      
 
Domain Number 2 Region: 373-561
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-30
Family Nucleotide and nucleoside kinases 0.0000136
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000942
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I4BL68
Sequence length 565
Comment (tr|A0A2I4BL68|A0A2I4BL68_9TELE) adenylate kinase isoenzyme 5 {ECO:0000313|RefSeq:XP_013868468.1} KW=Complete proteome OX=52670 OS=Austrofundulus limnaeus. GN=ak5 OC=Austrofundulus.
Sequence
MNTNDAKEYLSRREIPQLFESLLTGLMYYRPDDPIEYLEGCLKKVRELGGTDKVRWDTFV
GQEKKTLPPLNGGQSRRSLFRNVLPDSPNFPYRRFDRLPPINQFSIESDSDLSETAELIE
EYEVFDPSRPRPKVILVIGGPGSGKGTQSLKIAERYGFHYMSVGELLRKKMIHNATSNRK
WSLIAKIITNGELAPQETTITEIKQKIMKIPDANGIVIDGFPRDVGQALSFEDQICTPDL
VVFLACTNHRLKERLQKRAEQQGRPDDNPKAIDRRLTNFKQNTIPLVKYFQERGLIVTLD
ADRDEEEVFTDIGLTLDNKLFPSKEPAAGPSELDLSLLGETSSLSDAACRNDEVEEEEDI
GFAEGASESYCTDQKKPKVIFMMGGPGSGKALHCERLEERFGLRRLTLGDLLCSELQSHS
ERGRHLRDALERGERIPENTLLELLCDAVASSLRQGKGLVLTGFPRDLKQAEEYEAKMGE
PSAVLLLSCSPETMSSRLQCRGRSSSSSSDPENVLHRRAESFFSDSQALTAHYERRSLLH
TIDAERSPNEAFAQICQAIESCSTF
Download sequence
Identical sequences A0A2I4BL68
XP_013868468.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]