SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4CE40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4CE40
Domain Number 1 Region: 279-401,432-479
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-26
Family Nucleotide and nucleoside kinases 0.00037
Further Details:      
 
Domain Number 2 Region: 107-273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000115
Family Nucleotide and nucleoside kinases 0.0014
Further Details:      
 
Domain Number 3 Region: 14-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I4CE40
Sequence length 482
Comment (tr|A0A2I4CE40|A0A2I4CE40_9TELE) adenylate kinase 8 isoform X2 {ECO:0000313|RefSeq:XP_013878255.1} KW=Complete proteome OX=52670 OS=Austrofundulus limnaeus. GN=ak8 OC=Austrofundulus.
Sequence
MDETLKPVRIPPHMSIYADKHNLSHLVQSLVSSLVVDRPDDPISYLVDLLQRSRVDIPRV
MLLGPPAVGKHTLVSLNTPGSGSGSGSGSGSGSGSGSGSSSSVVVFQAKRLSAELKAVHV
TMEGLLEDQSELRALTEQDVPADLLVQLVQQRLKEVDCLQEGWVLEGIPQTRLQVLLLQQ
VGIIPDHVVMLEAPEEVLLQRAQGRLLDSLTGAQRLERGRGLSEEQLLAELQRYRCEVTG
LRSAYQHVLGVINADQPHTDVYHQALALVQTRHYSRTPRILLLGPPGSGKSLQARLLSEN
YKMVNVCCGQLLRSAAADGSGPGALVQPYLDDGRPVPDSVVLRVLEERLSRVDCSCRGWV
LHGFPLNLQQARSLQETQNQPNRVFLLEAPDHVCLERLSLRTVDPLSGERYHTVTRPAPS
AEVQARLQTAPEDRLEEVTQRLNQYRVHCAALQSVYPDVIHINANQNHLSVFEALESRLT
TN
Download sequence
Identical sequences A0A2I4CE40
XP_013878255.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]