SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4CWY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4CWY3
Domain Number 1 Region: 7-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I4CWY3
Sequence length 624
Comment (tr|A0A2I4CWY3|A0A2I4CWY3_9TELE) uncharacterized protein C8orf34 homolog isoform X1 {ECO:0000313|RefSeq:XP_013884497.1} KW=Complete proteome OX=52670 OS=Austrofundulus limnaeus. GN=LOC106532876 OC=Austrofundulus.
Sequence
MASPQQSRIQSYLEKNKIGPLFEELMTKLITETPDHPIPFLIDHLQTKQDSHGKLHRAFS
GSAALWAQSSPENKNPRREYSNFEKPWQITPKKPKKSKSDLAVSSISPPSPESKSLPRSV
EYPSWDWRESRDFDELSHILQESKKLGKALESLSRSIAISDELDQTFLGYNAVLRPRVVG
EWVGREDNDADPLAAEMLHPPVPRTKAEVCWSRDNSPAHSLKMETKSKGLKEQQQHHKKL
LAAMLSQDSFDQVNSHIPSVLEEEIEDEDDAMELLEDLDDLRMEGVTRLAPSGSKFSQGR
SSYQPEPQAKVTLNICSRCARLQGDTLSNSRSEEEHRPHVPEQAVPDISLPLPGVDTAAG
RLQECEALSQVSASRRTVWAADLKAVRGGSSVGQTGLLLGDPLFSKELENMGKQLAEVEK
DLAKLAEVGKMTSRSSNNPHGSLVHNPLHHRALPDTLPLASLVSRPQSPSFSANPCGVGL
PLLSPKSTSLTMSRTRSPSNPGSRTQTPRTPSRPLTPTSLLTRSTFNTGSHKEVTFRRSR
SRPVTPTSQPILPRPLLTPPGLSTTDSLGASLRAYLSEDEFYQQLQAIRQPWHIPSDTDS
DILEPPEQDKSGSRDGKRSVFSGL
Download sequence
Identical sequences A0A2I4CWY3
XP_013884497.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]