SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4DQS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4DQS4
Domain Number 1 Region: 79-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.17e-17
Family Ankyrin repeat 0.0059
Further Details:      
 
Domain Number 2 Region: 238-256,321-407
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000602
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I4DQS4
Sequence length 630
Comment (tr|A0A2I4DQS4|A0A2I4DQS4_9ROSI) ankyrin repeat-containing protein ITN1-like {ECO:0000313|RefSeq:XP_018809501.1} KW=Complete proteome OX=51240 OS=Juglans regia (English walnut). GN=LOC108982546 OC=Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans.
Sequence
MRALSIFKEHLKIKKIIETIARSGLGMEGFYSAPSSPEPEHYWDAATSLDQELSSSEDAE
NEANERTRRFHFLDTSVRLYQAALKGDWSAAKDVFDKYPDAITYPITRQKDTVLHIAAAA
KRTDFVKELVKLMNPSDLEIKNKQNHTAICFATASGIVAIAEEMVNKNNELPLIRVSNGS
ITPLYMAALQGRRNMVAYLDSVTAFERLTPLERIDILVASISSDLYDIALKILKRDPALA
TMENTYGKIALQELAKKPYAIGSKSQLSVWERCLNSWPFRGIYSKALMRIIAHQLVDLLW
ENFRQLPQKKFRKLVHDHSSFLFDAARSGNVEFLIILIRSYPDLIWSVDQNKRSIFHLAI
KYRQENVFNLIYELGAIKDIIALYTDQNNNNMLHLAAEIAPDIPNRLNIVSGAALNMQRE
LLWFKEIETIVQPSYTKKVNLDLKKNPRELFTITHEHLQKEGEKWMKDTANYGMLVAALI
ATVVFTAAFAVPGGNNQELGIPILLRSNWFLAFFISDAIALLSSSTSILIFSSILTSRYA
EKDFLHSLPARLLLGLTTLFISIASMVVAFSATCFLVYDSEIASVPIIIISLACIPVTMF
FILHYRLWADIFRSTYGSRFLFRPRERRLF
Download sequence
Identical sequences A0A2I4DQS4
XP_018809501.1.44688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]