SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4DUI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4DUI2
Domain Number 1 Region: 22-124
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000288
Family Pseudo ankyrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I4DUI2
Sequence length 357
Comment (tr|A0A2I4DUI2|A0A2I4DUI2_9ROSI) ankyrin repeat-containing protein At5g02620-like isoform X2 {ECO:0000313|RefSeq:XP_018810802.1} KW=Complete proteome OX=51240 OS=Juglans regia (English walnut). GN=LOC108983575 OC=Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans.
Sequence
MLKLLGVYNKALMGTIAHQLVDLLWKNVLLLPEKDFIMLVRGHSSFLFDAARSGNVEFLI
VLIRSYPDLIWRVDEKNRSIFHLAIKYRQESVFNLIYELGSIKGIIALYTDQDNNNMLHL
AAEIAPPDRLNTISGAALQVQRELLWFKEIEKIVQHSYTEMMNLDENKKPADTPWELFTQ
THENLQKEGEKWMKDTANYSMLVATLIATVVFTAAFTVPGGNRQDLGIPIFLRNNWFMAF
FISDAITLLSSSTAILIFLSILTSRYAEEDFLQSLPARLLFGLTALFISIAGMVVTFSAT
CFLVYDSEIESIPIVIISLAGIPVTLFFILHFRLWADIFRSTYGSRFLFRPHERRLF
Download sequence
Identical sequences A0A2I4DUI2
XP_018810802.1.44688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]