SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4E9V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4E9V0
Domain Number 1 Region: 95-221,252-306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.63e-34
Family Nucleotide and nucleoside kinases 0.000000871
Further Details:      
 
Domain Number 2 Region: 220-250
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000000109
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I4E9V0
Sequence length 319
Comment (tr|A0A2I4E9V0|A0A2I4E9V0_9ROSI) adenylate kinase, chloroplastic isoform X1 {ECO:0000313|RefSeq:XP_018816168.1} KW=Complete proteome OX=51240 OS=Juglans regia (English walnut). GN=LOC108987660 OC=Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans.
Sequence
MACIVNFSAITQPKPQPCFASLPASTSSHRSNSPKLQTSYLSFASNNSRISLRYDRTLAV
SPPRETLLSKAPNFMVGLISCFSDHEQIVAAAKKPEPLKIMISGAPASGKGTQCELITQK
YGLVHVAAGDLLRAEVAAGSENGRRAKQFMEKGQLVPDEIVVMMVKERLLRPDAHKNGWL
LDGYPRSSSQATALKEFGFEPDLFILLDVAEDTLVERVVGRRLDPVTGKIYHLKYSPPET
EEIAARLTQRFDDTEEKVKLRLRTHHQNVEAVLSMYKDITVKVNGNLSKNDVFAKIDSVL
DELLEQRKAGSGYLEANKA
Download sequence
Identical sequences A0A2I4E9V0
XP_018816168.1.44688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]