SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4EH06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4EH06
Domain Number 1 Region: 44-203
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000012
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I4EH06
Sequence length 435
Comment (tr|A0A2I4EH06|A0A2I4EH06_9ROSI) ankyrin repeat-containing protein NPR4-like {ECO:0000313|RefSeq:XP_018818674.1} KW=Complete proteome OX=51240 OS=Juglans regia (English walnut). GN=LOC108989503 OC=Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans.
Sequence
MACKRDGDQKTALHVLADQKAPDDEIITSCKDPIKSGNWPLFSACFRKLQAASKSEISKR
DELLEMILNELQKKSIEEISEVLKRTTSEVVKTTTTSEVLKSSTNREVVKTTTTSDEVVK
STTSEVLFDAAMSGNVEFLDKVLRKFPMLIWENDHEKDRSIFHVAIQYRQEKVFNLIYNI
GAVKDYLVGNKDYDGNNMLHLAGMLPDDHQERLGMPRADLRMQRELLWFKEVKKIVRPYQ
RSEKNKEGMTPKDVFNATHKDLVKEAERTVRETARSCMLVSTLIATVTFAAALTVPGASN
KNMTPLLSKEQWTSFFILSNAVALFTSASSIISSLSVLTSSYAQKEFVKSLHVRLMFGLT
TLFLSITAMLLTFIAVMFLIFDYKKLAWLPYLIVILGSGPLFLFLGLHLGLFTDLIRAYY
WSSYLCRPSKHRIFE
Download sequence
Identical sequences A0A2I4EH06
XP_018818674.1.44688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]