SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4FNI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4FNI3
Domain Number 1 Region: 22-216
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.17e-23
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 453-532
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000811
Family Pseudo ankyrin repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I4FNI3
Sequence length 755
Comment (tr|A0A2I4FNI3|A0A2I4FNI3_9ROSI) uncharacterized protein LOC109000680 {ECO:0000313|RefSeq:XP_018833193.1} KW=Complete proteome OX=51240 OS=Juglans regia (English walnut). GN=LOC109000680 OC=Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans.
Sequence
MSSMDPEMLIKRSLDQQISRDLLKKAMMGQWNEVVEIYKKEAWTHKEKITRSGETALHIA
VSDGQKEIVKELIEVIKSQTDDQNHAKEAVSVENKQGNTALHLAASKKEPSMCKSIAEVN
SSLVGCRNHEGETPFFLAAFHGKKRAFLCLHQICAKTNQVGYYYSARKDGNTTLHCAING
EHFDLAYQIIHLYPDLANWANKKGLYPLHILAAKPSAFRSGKPLGAIWHRAIYNRIVVDE
LKPELQPDLEDDIPNNHPRRELTGFVNPFSWKHMFACLVPKPRGTNGTGEGIHDDDELDH
YTYPTTVIDINLSREYYSGTHHDHGGIFSRFFKFAYSKTMWIISWSMVITSWFLYIFTSQ
FMGMLLLPFGIKGYSRRRRMEHAIRSSYYVKQKHTWAVQIMNILLERTTDLYQAGFETWA
NVGEHGDRINDHESNERSRAEGVSLADQDRETPILTAAKYGVIEMVERILELYPIAIYDV
TSVTNKNIVLLAVEKRQIHVYQLLLQKTIPRDSVFGHVDEDGNSALHLAANLPPNTPGMI
PGLQMLWEIKWYQFVKDSMPPYFFPLHNKENKTPIEMFTKNHRKLVRSGGKWLSRTSNSS
SVVATLIASVAFATATTIPGGLTQDCGTTMYGNQPAFSIFAISSLLAVFFSVASVVMFFT
LISSHYEARDFSSNLPKKLLMSLMTLFIGITSLLISFCVAHFFLLQDKQNNEAWVLYAVV
VASVIYLTIKNSSVFLNLMRVTFSDVPERLYEDDV
Download sequence
Identical sequences A0A2I4FNI3
XP_018833193.1.44688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]