SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4HL02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4HL02
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000484
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I4HL02
Sequence length 403
Comment (tr|A0A2I4HL02|A0A2I4HL02_9ROSI) ankyrin repeat-containing protein ITN1-like {ECO:0000313|RefSeq:XP_018856782.1} KW=Complete proteome OX=51240 OS=Juglans regia (English walnut). GN=LOC109019019 OC=Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans.
Sequence
MLARKPSAMGSKSTSAAGINTMGKMLSSCFKGLMSNRVLANDLVEALWKDFGDHKNFSST
STIQNHMKILVEAAKVGNVEFIKVFIRSYPDLIWQVDEEYGSLFHVAVKHRQESVFNLIY
ETGVMKTNLATYIDKEGNNMLHLAAELPSPNRLNIVSGAALQMQREMLWFQEIKKIMPNS
YVIETNKKGQTPKEIFMKSHEDLQKKGEKWMKGTANYCMLVAALIATVVFPAAFTVPGGN
NQDTGIPIFLETNWFRIFFISDAVAMLFSSSSVLVFLSVLTSRYTEKDFIKTLPQRLALG
LGTLLISIVAMLLAFTAASFLVFQCKTPSVPIGIIVAAPVIPISLFVMLHYALWFDIFRS
AFISNLLFRSQHKLFEARKEWQSPVCMQLRFGTKFKQMIRPSV
Download sequence
Identical sequences A0A2I4HL02
XP_018856782.1.44688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]