SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I6DUJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2I6DUJ2
Domain Number - Region: 49-113
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0772
Family Pseudo ankyrin repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I6DUJ2
Sequence length 375
Comment (tr|A0A2I6DUJ2|A0A2I6DUJ2_ENTFC) ABC transporter permease {ECO:0000313|EMBL:AUJ66648.1} OX=1352 OS=Enterococcus faecium (Streptococcus faecium). GN=CDW54_03450 OC=Enterococcus.
Sequence
MSLLTFERNLLLKNKVNFLFPLLLVVLFAFPLFFDHKLAYTEFDELNHNYEEMQRLIETL
KEDENEKEFVESLEKSNKLIEAILHAKNTGNVQQMVEATYHYEKDILDRLISGQRQGIPI
IEQQKRVELLRYMKEHQIQRYSIFDLPAHLPLANYYENIFSGMISSFLILCITALFLSSI
ISYEKRKQVISLVNLLPDSMVKKHSIRFTVYYGAAMLSLVMPFLIVSILVIIKNGLGDFR
YPVGTIIGQEIRILPMYAYLFQSFLFLLLWVLFLSTISFLLSALFEHSLVNLLGTLLCLF
LAEYRLFSSIGWIESISHYLPTSYVDFQNVIIGGDIFSPLASEQVTFMNGILTLGIWSIV
LLFIGMGTIYIKKSY
Download sequence
Identical sequences A0A2I6DUJ2
WP_010718040.1.13225 WP_010718040.1.38563 WP_010718040.1.43830 WP_010718040.1.4689 WP_010718040.1.47710 WP_010718040.1.50112 WP_010718040.1.59891 WP_010718040.1.63877 WP_010718040.1.68696 WP_010718040.1.72036 WP_010718040.1.75535 WP_010718040.1.83469 WP_010718040.1.88321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]