SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I8GGJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I8GGJ0
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily YfbU-like 1.01e-33
Family YfbU-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I8GGJ0
Sequence length 183
Comment (tr|A0A2I8GGJ0|A0A2I8GGJ0_PROMI) Uncharacterized protein {ECO:0000313|EMBL:AUT91554.1} OX=584 OS=Proteus mirabilis. GN=MC46_007470 OC=Morganellaceae; Proteus.
Sequence
MKYSQAEKLQLMMLCEIYRVMGIENSFNPDLVEEAISTDNYWALSWEYPSLETEDETPSK
VKLFVDTVDMYDMLSYTYERLSDEDKKDVSEAVPHFSPEYSLTFPGFDGNNESEYMQIGR
LLKTMGRFSGTELTKNSHAPSVETYRRMLDIFLPIRHKFVFNEGIRKQELIDILLERIHP
SNR
Download sequence
Identical sequences A0A2I8GGJ0
WP_017628805.1.11678 WP_017628805.1.1430 WP_017628805.1.20820 WP_017628805.1.27951 WP_017628805.1.38518 WP_017628805.1.43876 WP_017628805.1.9132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]