SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I8VIV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I8VIV5
Domain Number 1 Region: 8-52
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000123
Family Preprotein translocase SecE subunit 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I8VIV5
Sequence length 57
Comment (tr|A0A2I8VIV5|A0A2I8VIV5_9EURY) Protein translocase SEC61 complex subunit gamma {ECO:0000313|EMBL:AUV80989.1} OX=755307 OS=Salinigranum rubrum. GN=C2R22_04380 OC=Salinigranum.
Sequence
MDVKYDLTSYVRVLKLASTPSWEEFSQISKIAGAGIFLVGFLGFVIFAVMSFLPGGV
Download sequence
Identical sequences A0A2I8VIV5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]