SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J5HLC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J5HLC6
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.75e-86
Family Capz beta-1 subunit 0.0000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J5HLC6
Sequence length 266
Comment (tr|A0A2J5HLC6|A0A2J5HLC6_9EURO) F-actin capping protein, beta subunit {ECO:0000313|EMBL:PLN77907.1} OX=482145 OS=Aspergillus taichungensis. GN=BDW42DRAFT_175942 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MADAQFDSALDLLRRLNPRDTKQHLNAITTIVPDLAEDLLSSVDQPLEIRRCPKSSRDYL
LCDYNRDGDSYRSPWSNEFDPPLDDGTVPSERVRKLEIAANEAFDVYRELYYEGGVGSVY
FWDLDDGFAGVILLKKGVTPGGKSSGEWDSIHVFEATDRARMSHYKLTSTVILHLANETE
ALGEMDLSGNMTRQVEVDLPVESDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGE
LRSISSLSESSKERANHAEMIRSMHG
Download sequence
Identical sequences A0A2J5HLC6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]