SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J6N5K3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6N5K3
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily MTH1598-like 4.45e-38
Family MTH1598-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J6N5K3
Sequence length 144
Comment (tr|A0A2J6N5K3|A0A2J6N5K3_9CREN) Archease {ECO:0000313|EMBL:PMB76506.1} KW=Complete proteome OX=683846 OS=Fervidicoccus fontis. GN=C0177_05845 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MEGEGYSFEEHTSDVIIVARGKTLERAFEYIAKGLMEIMTNPSQIDIKEKKELKVNGFDL
ENLLYRWVEEFLYLFDAEGFLAREIKVEKIEKLNEEYLVNGVAYGERYNERKHESRTHVK
APTYSQINVTRESDLWKLKITVDI
Download sequence
Identical sequences A0A2J6N5K3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]