SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J6PE32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6PE32
Domain Number 1 Region: 347-533
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000785
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J6PE32
Sequence length 602
Comment (tr|A0A2J6PE32|A0A2J6PE32_9HELO) Uncharacterized protein {ECO:0000313|EMBL:PMD12287.1} OX=1745343 OS=Pezoloma ericae. GN=NA56DRAFT_587448 OC=Helotiales; Leotiaceae; Pezoloma.
Sequence
MILRQYGDQVPIARSSVVEDAAQNEWCGKEILELLFLRCGNQIYITEATVRYAARNKRSG
LEILELLICERRGEVETTEDVWKAAAENSGCGLDIVRLLLGQCCDEVRITEKLAVEVVSR
MWHDKQKTLAQLIRRCAHVFRISENTVSAIARSFDQHMMALLLETQGGMLPITESVLVAV
AQNTQSAPHTMYLLLQERVSMVSISDAVVKAAIENFHCGGRLLRMLLERRGDEIRITENH
VISAAGVSHYMLQFLLRERPGEVHINEAVLVVVARNEWAGEPIVKLLLPGRTGEMEITGR
VLEAAASNTRSGEEILKLLLQNYDDEIPIGIVEAAAGNTRSGTRITSLLFQEREHEIQIT
EKVVTAAARNPELGEEILELLFQKRRGEIQVTASMMQAAMGNPVSSEQVMEILLHHCDDD
FQMDPTTAAMAAANLTSGRALMEQLLHRLGAQVQPTEDVLEAAAQNDKCGFDIVEMLLLE
HADTAHVTTKVVKAALRNERCGLNIIELLLHERCHVRITEEMIVAAVESQHATRFLTLLL
DKVGSSQITDRVVESAARNASHGKEIMRLLVDKYGEEIPISEDVKRATAEKSETGGQIME
LL
Download sequence
Identical sequences A0A2J6PE32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]