SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J6PPD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6PPD4
Domain Number 1 Region: 34-208
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.01e-26
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00038
Further Details:      
 
Domain Number 2 Region: 402-460,487-540
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000131
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J6PPD4
Sequence length 630
Comment (tr|A0A2J6PPD4|A0A2J6PPD4_9HELO) Flavo protein {ECO:0000313|EMBL:PMD15887.1} OX=1745343 OS=Pezoloma ericae. GN=NA56DRAFT_649927 OC=Helotiales; Leotiaceae; Pezoloma.
Sequence
MAEHTPALRTRFINSIPKASSSTSIADMRVNEFPRLRVLVASNGPKEVAQALSLVVRLSK
NPKIETRAIIDEESWPANRLSQETLTLPNRYFRPCRETDEARKGIERSQIEFYRQQAAEL
CDWADVMVLAPIDADTLAKMLHGMTDCLVLEILRGWDVSKKILLVPGMTTSMWENPMTKK
QLSKMKRKWKWVRVMQPILWQYEEKGKVVPGYDGFNELIDAIKNQAELLTIGHDVDIAAS
GAASLARYNLKTDALLPPEIWTLIFEYVGDWEVSRALNIYAKLPTPPEWKKPVKEPKDEL
QIWMRSLEWTILTSPTSKIIDKLKTAPEDLKFLSSLCVKLIIKFCLTSLLTYLETNCKDV
FWASFGQKLLPTKASAVYGRTEILEWWRTSPSFLSKDYTAEAIDGASKSGFVHVLDWWRR
SGLPLKYTELALEQASSKGHILVLEWWKQANMHQGSFHTDVETRHRHPSPPLTEEGSQSE
VQPALRLKPGKSLLAAAQNNQPLVIRWWDNSGIPIGYSEAVAKTASAHGHVAVLDAWREI
KGEKMAFDSKVLAEPTKNGHVAVLEWWKNFSRGEDGRPGGRVEYKTCDIEEALEDSVGSE
DETFQVKKWWAQNGLNLGGTVSEWTKVKFL
Download sequence
Identical sequences A0A2J6PPD4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]