SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J6Q4W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6Q4W3
Domain Number 1 Region: 248-335
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000085
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J6Q4W3
Sequence length 363
Comment (tr|A0A2J6Q4W3|A0A2J6Q4W3_9HELO) Uncharacterized protein {ECO:0000313|EMBL:PMD21320.1} OX=1745343 OS=Pezoloma ericae. GN=NA56DRAFT_703496 OC=Helotiales; Leotiaceae; Pezoloma.
Sequence
MACSIPTAPALPELVLAASSLHKRAEQILKLSQFCQLCLRNPDRTFTQPEYHAVEKFVDK
AFNLTQTLSRPEKNEQSRLLSQACLNFAQAAFGKTHYTTAEVYFRKASNLALDMSNMIPA
GGDSKDAFSMIATCSFHLKKFKDGENAIIALRTFPDVSLEDTIRSLEAYSSPTAGDHLSV
EIHQEMLRKVYYGGLLQYSPRTSGKEESDEGRVENLRGLCPIKAALGLEEITRSLNGRRH
HQGKTNPQDLLFFAVNDNSCAALDLLLTAWSPSSYLHHIPESSRVHGVGPWVPDKVMCLH
GCLHEAARRRNIEMVETLINAGASIYGRNGEGRNPYEMLCARDSKFHGLRTQFFSIFWDG
ERE
Download sequence
Identical sequences A0A2J6Q4W3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]