SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7PM86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7PM86
Domain Number 1 Region: 11-53
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000968
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J7PM86
Sequence length 265
Comment (tr|A0A2J7PM86|A0A2J7PM86_9NEOP) Ropporin-1-like protein {ECO:0000313|EMBL:PNF17443.1} KW=Complete proteome OX=105785 OS=Cryptotermes secundus. GN=B7P43_G02977 OC=Termitoidae; Kalotermitidae; Cryptotermitinae; Cryptotermes.
Sequence
MPDLVEQTYCSQQIHIPPTFPFILKQYAKAAIRTQPYDLLRWSATYFRALAQGDEPPVKK
RLECPPVESQFGLSPGYLRVLLKQIGFLNSVSVEMLRDKWQGICLDENTLNELLKLGGFT
ENVDWLKFIAIAAGHLTNSLTQTMYLICELLTEEPEGGSDMIPFETFKELYAYLAQMNCG
PRKGEEEASDGNIKSGEEAPILGADEATSAELGSGINIPGIGPLIPTAQIQSVLKYLEYL
AGQQNGMVMPRNLHHFLCPSLDKVL
Download sequence
Identical sequences A0A2J7PM86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]