SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7ZLX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7ZLX9
Domain Number 1 Region: 1060-1132,1229-1350
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000127
Family Ankyrin repeat 0.0045
Further Details:      
 
Domain Number 2 Region: 705-865
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000137
Family Ankyrin repeat 0.0062
Further Details:      
 
Domain Number 3 Region: 85-374
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000708
Family Ankyrin repeat 0.0054
Further Details:      
 
Domain Number 4 Region: 498-579
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000118
Family Pseudo ankyrin repeat 0.024
Further Details:      
 
Domain Number 5 Region: 1354-1434
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000366
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J7ZLX9
Sequence length 1508
Comment (tr|A0A2J7ZLX9|A0A2J7ZLX9_9CHLO) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:PNH01265.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_012861 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
ASAATSDTSRIWLPEFVERFAASLRPNEVACALRLVNKATAAQFCAPQQTTVRLSQPVPR
HAFAWRWGGTDSMRALARQQRLELLRLTARSGSVANLEVLIGRDDSTPVLDYGVFRAAAA
AGQLDVCVWLRQRGCPWHKGIWAAASGGGQQAVCEWLLANGCLKVDNHRRATAAAARGGH
VGLMDWLLLRADSTWVVAAAVLPRAAAEGCNLDTLQRLHHTHVDTLPGGLLQRGYPLGNY
VAASAAGAGNMAALQYVLGQGSGVDDDMMVTAAEGGHIAVMEVLRVRCAPMDEETVRTAA
AAGHLQAVAWLVERLGADRALKTDVFAAAAQAGSMELLGWLRVWGCPWDATVFAAGAEGG
SEEQLEWLVEQGCLMGRGPPLQRSMGSHRARKRQRARPPASPPQQLQQQAIGPAACSDRV
WLPELVQRFAASLQPNEGVCTLRLVTKATAAQFRGPQHITVRLSQPVPHHAFAWRWAGPD
AVRNLARRQRLELPRLTARSGSIANLEVLLARDDWPPVLSYDVFRAAAAAGQLDMCVWLR
QQDCPWRKGILAAAAGGGHKAVCERLLANGCPKVDNHWGATAAAARGGHVGLMDWLLLRA
DSTNVPQLLAGAAEGCDLPTLQRLHDTHVDALPGGLPAPYKPSTLSAAAGSPTADWQAKV
EWLEARGYPQTAEACEKAAARPDALPRLQWLRQRGYPLNMGVALRAAEAGNMEALQHVLG
QGVEIDDDMMAGAALGGHVAVMEVMHARGVPMGEETVRTAAAAGHLPAVAWLVERLAADT
ALTADVFAAAAQAGSMELLRWLRARGCAWDETVLAAGAEGGSEEQLEWLVEQGCPMGDDG
EPYVRAARHGDLAMLRCLRRLGCPWGSGGSTLARAVEGFPGNSYNSGGILEHVLSWLLDQ
GCPVDWDAAEAAAEDKDDEELMGWLQEQRNQRAQIGSAAALLASMEPQRAQERQRPWPLA
PPPPPQHDTAASASSSDPSRVWLPEFVERFAVSLMPNEVACALRLVNKATAAQLSAPQHT
TVRLSQPVPRHAFAWCWGGTDSMRALARQQRLELQRLTARSGSVANLEMLLARGDLPPVL
DYGVFRAAAAAGQLDVCVWLWQWGHPWHVEIMVAAAGGGHKAVCEWLLANGCPNVENHWV
ATAAAARGGHLGLMDWLLLRADGTHKSNSVTAVVRGAAEGCDLPTLQRLHHTHVDTLSEG
LSAWYINFIITAAASSRTADWQAKVEWLEARGYPQTAEACMAAAAKLDALPRLQWLRQRG
YPLGNYVAASAAEAGNMEALQYVLDEGVEVPMDDDMMRCAARGGHVAVMELLHARGAPMG
EETVGAAAAAGHLPAVAWLVERLGADRALTKDVFAAAARAGSMELLGWLRVRGCPWDATV
FTAGAAGGSEEQLEWLVEQGCLMGDDGEPYVRAARNGDLAMLRCLRRLGCPWGPGGSTFT
RAVAGLINEIWDYVEPVEHVLSFLLDGGCPVDWDAAEAAAEDARDKARTGWLQMQRKERA
HIGSGGLP
Download sequence
Identical sequences A0A2J7ZLX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]