SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7ZM88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7ZM88
Domain Number 1 Region: 662-794
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000261
Family Ankyrin repeat 0.005
Further Details:      
 
Domain Number 2 Region: 1127-1257
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000671
Family Ankyrin repeat 0.0049
Further Details:      
 
Domain Number 3 Region: 917-1020
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000028
Family Ankyrin repeat 0.0065
Further Details:      
 
Domain Number 4 Region: 184-282
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000418
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J7ZM88
Sequence length 1340
Comment (tr|A0A2J7ZM88|A0A2J7ZM88_9CHLO) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:PNH01383.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_012740 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MCECSEWLLVNGCSEVANYLGAAASAARGGHVGLMDWLLMRAKRTDLAAVLAEAAEGCDL
PTLQRLHHNHVDTLPGGLSAAWYKRVMLSAAAGSPTADWRAKVEWLEAQGCAQTAEACHV
AAAKPDALTRLQWLQQQGYPLDMFVAGDAAEAGNVEALQYVLSQGVGVHPRMMQSRRYTV
DEDTVRAAAAGGHLPAVSWLVERLGAGAALTTYVFEAAAKAGSMELLRWLRAGVAGYGSE
EQLEWLVEQGCCMGDDGEPYVRAARHGDLAMLRCLRRLGCPWLRHAVALMFRSSHIHGEP
VQRVLSWLLDQGCPVDWEHLEAAAKYVDDEGLMGWLQAQRNMELQRAHKRQRRSQSPASP
PHQQQPAAASYPSRIWLPDIVQHFAASLTSNEVACALRLVNKATAAQFRAAQHTTVRLSQ
PVPHHAFVWRWAGPDAVRTLTRQQRLELPCLTVCSGSIANLEVLRARDDLPPAPDCQVSW
AAAAVAAGQLDVCVWLKEQGCTFQEEDALTAAARSGQQGVCEWLLANGCSEVANYLGAAA
SAARGGHVGLMDWLLMRANRTDLAAVLAEAAEGCDLPTLQHLQHTHVDTLPGGLSAAWYK
HVMLIAAAGSPTADWRAKVEWLEVQGCAQTAEACHVAAARPDALTRLQWLRQRGYPLDMF
VAGDAAEAGNVEALQYVLSQGVGVRSDMMQRAAERGHVAVMEVLHARGVRMDEETVRLAA
AGGHLPAVAWLVERLGAGATLTTYVFEAAAKTGSVELLRWLRAGACPWDATVFAAVAGYG
SEEQLEWLLEQGCCMGGHPSVRCSMELQWAHKRQRRSQSPASPPQQQQPAATSDPSRIWL
PDIVQHFAASLTSNEVACALRLVNKATAAQFRAAQHTTVRLSQPVPHHAFVWRWAGPDAV
RTLARQQRRELPRLTARSGSIANLEVLRARDVLPPAPDCQVSWAAAAAAAGQLDVCVWLK
EQGCTFQEEDALTAAARSGQQGVCEWLLANGCSEVANYLGAAASAARGGHVGLMDWLLLR
ANRTDLAAVLAGAAEGCDLPTLQRLQHAHVDTLPGGLSAAWYKRVMLIAAAGSPTADWRA
KVEWLEAQGCAQTAEACHVAAAKPDALTRLQWLRQRGYPLDRDVAASVAEAGNVEALQYV
LSQGVGVHPGMMQRAARRGHVAIMEVLHARGVRIGKGTVRLAAAGGHLPAVAWLVERLGA
GAVLTTDVFEAAAKTGSVELLRWLRAGACPRDATVFAAVTGYGSEEQLEWLLEQGCLMGV
GTGGRMMVSRTGDLVMLRCLWRLGCPWRPDSITLAREVALMIYELHGSGEPVQRMLSWLL
DHGCPMDGLGRGGGNCKGRR
Download sequence
Identical sequences A0A2J7ZM88

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]