SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7ZN53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7ZN53
Domain Number 1 Region: 150-230,358-461
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000508
Family Ankyrin repeat 0.0072
Further Details:      
 
Domain Number 2 Region: 509-509
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000183
Family Pseudo ankyrin repeat 0.12
Further Details:      
 
Domain Number 3 Region: 329-406,593-667
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000357
Family Ankyrin repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J7ZN53
Sequence length 771
Comment (tr|A0A2J7ZN53|A0A2J7ZN53_9CHLO) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:PNH01680.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_012417 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MEQQRDCIGQRSDQLGSLAPTLPPGGSALLPDPQQQGEAASAAADPSRIWLPELVQRYAR
SLSCNEVACVLRLVNKATAAQFGEPQDRTVRLSLPVPLHAFVQHWNEVGAMRGLIRQQRW
RLVQLTARSGSIANLEVLLAREDCACLSDKALYAAAGAGQLDVCRWLREQGCLWGVDPSD
LDAAAHGGHQDVCEWLLASGCPWSDGAAGDAARGGHVGLVDWLLGTGHDSPLEGLVAPAA
AGCDLPILQRLYSAHFTQRNSDFDKTSVLACAAGSSTADWRAKVEWLEGRGFPRTAEACR
AAVGQPDWRGRLEWLQQRGYPLHANMAVTAAGVGVVDALQYVLDSGVALDEGTAQYAAIY
AARGGHLAVLQALHARGLPIEAAAAAAARHGHLSVVAWLAEALGADEVLSARVFAAAAGS
GSVSMLAWLHDRVCPWDHRAFAEAADTGCEEQLEWLAARGCPMGVGPGCATEDWRAKVEW
LEGQGYRRTAEACLEAVKQPDWRGHLEWLQQRGYPLDGDVAVTAAEVGIVDVLDSGVALG
EDTAAYAAFKAGMEGHLAVLQALHARGLPVEEAAAPAARRGQLPVMAWLAEALGASKVLT
TQLFAAAAQSGSVELLAWLHDRGCPWDESVFENAADTGCEEQLEWLAERGCPMGEGGEPY
ACAARTGELAILRCLQRLGCPLGPESGGVFVRTIDSRWPLHNSCDTLRLQRGLLWLLERP
DGENVPTPLDAAGCGSRLREPAAGAGCGSRLREPAAGAGYGSRLKVARMNK
Download sequence
Identical sequences A0A2J7ZN53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]