SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7ZPD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7ZPD3
Domain Number 1 Region: 352-488
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000286
Family Ankyrin repeat 0.0093
Further Details:      
 
Domain Number 2 Region: 144-234
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000876
Family Pseudo ankyrin repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J7ZPD3
Sequence length 565
Comment (tr|A0A2J7ZPD3|A0A2J7ZPD3_9CHLO) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:PNH02135.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_011914 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MEPQREILPPQTEPPTEPPREPCIAPGPRQQQDGAASFESAADPSRIWLPELVQRYARSL
SCNEVACALRLVSKATAAQFRGLQDRTVRLSLPVPHHAFVQRWGGVGAMRSLTLDQRRQL
PCLTARSGSIANLEVLRAREDTAACESDVEVLKAAARAGQLEVCLWLRQQGCPWYCSTLG
AAAEGGQQAVCEWLLTSGCPWSEEAASEAAKGGHVGLMAWLLGTGQYLNGHTLLSGVVEG
CDLPTLQRLHSTHFTQQLGEYSRGTVLASAAGSATADGAKVEWLEGQGYPRTAEACAEAV
KRPDWRGRLEWLQQRGYPLDGGVAVAAAKAGVLDAFQVVLESGVELDQHTTKNVARCAAE
RGHLAVLQALYPRGIGNIATAAAAAAERGHLPVVVWLAETLGAVKVLSAEVFVAAARSGN
MELLAWLHGRGCPWDESVFAAAADTGCEEQLEWLAARGCPMGEDGTPYVWAAKNGDLATL
RCLQRLGCPLGPESGRVFVRAIDCGQPLCYPLHMLQLQRGLLWLLERVGKVVDWDEVERT
VQRGANGVLDDELLTWVRAQRAQRV
Download sequence
Identical sequences A0A2J7ZPD3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]