SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7ZRH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7ZRH1
Domain Number 1 Region: 1832-2052
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000639
Family Ankyrin repeat 0.012
Further Details:      
 
Domain Number 2 Region: 1286-1490
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000119
Family Ankyrin repeat 0.0059
Further Details:      
 
Domain Number 3 Region: 792-931
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000202
Family Ankyrin repeat 0.007
Further Details:      
 
Domain Number 4 Region: 2357-2573
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000696
Family Ankyrin repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 351-493
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000018
Family Ankyrin repeat 0.0067
Further Details:      
 
Domain Number 6 Region: 2906-3034
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000222
Family Pseudo ankyrin repeat 0.027
Further Details:      
 
Domain Number 7 Region: 2710-3037
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000298
Family Ankyrin repeat 0.0075
Further Details:      
 
Domain Number 8 Region: 1605-1692
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000445
Family Pseudo ankyrin repeat 0.018
Further Details:      
 
Domain Number 9 Region: 166-262,357-368
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000127
Family Pseudo ankyrin repeat 0.029
Further Details:      
 
Domain Number 10 Region: 3224-3463
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000174
Family Ankyrin repeat 0.014
Further Details:      
 
Domain Number 11 Region: 1522-1560
Classification Level Classification E-value
Superfamily F-box domain 0.0000114
Family F-box domain 0.0052
Further Details:      
 
Domain Number 12 Region: 2058-2099
Classification Level Classification E-value
Superfamily F-box domain 0.0000118
Family F-box domain 0.0063
Further Details:      
 
Domain Number 13 Region: 2598-2643
Classification Level Classification E-value
Superfamily F-box domain 0.0000275
Family F-box domain 0.0059
Further Details:      
 
Domain Number 14 Region: 2168-2383
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000421
Family Ankyrin repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J7ZRH1
Sequence length 3478
Comment (tr|A0A2J7ZRH1|A0A2J7ZRH1_9CHLO) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:PNH02875.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_011112 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
LRQHQPHPDRPCLPMEQQQPGMTQRTQSPTRSPPPPLQQPQQQQQAQQLQPDAVPGAADP
SRIWLPEVVHHFARFLGGNELAATLRLVNKATAAQFRGRQHTTIRLSLPVPHHAFVWRWG
GLNATRSLTVRQRKQLPCLTARSGSISNLEVLLPRDDLTSPLSDAVLEAAAGAGQLEACR
WLRQLGCPLDDALPMWKAAARGGHRAVCEWLVDEDDRPPEDVWVFSAAAARGGHVDLMDW
LLERTAGAQGFCVPYVLAAAAAGCGLLTLQRLHHTYLDSRGEELPDYIQELLVAAAAGSP
TADWRDKVEWLEGRGCPRTGPACRVAAKRVDGRERLEWLQQRGYPLTAAGAYQAATHGNA
DALEFLLAQGVELGEELAGHATYQATSSGHLAALKVLHAHGARFNGSTVATAAEAGHLPA
VAWLVETLGATVALTADLFVRAAESGNAGLLAWLHEHSCPKSASVFAAAAAFGSEEQLEW
LAGHGCPMGQQDQQQQQQQPDSVPGVSIDDPSRVWLPEVVHHFAGFLGGNELAATLPLVN
KAAAAQFHGPQHTTIRLSLLVPHHAFVWRWGGPNATRTLTVQQRKQLPCLTARSGSISNL
DVLLARVPWPVLRWRPLPLEVCRWLQLQDGILDDTSTLQLAAAGGHRAVCEWLIDEGDRP
ADVWAASAAAARGGHVGLMDWLLERTADAQGSDVANLLAAAAAGCDLPTLQRLHHTYLDS
RGGQLPEAEQDEVVAAADGTPTADWRDKVEWLEGRGYPRADSACRKAAQRVDGRERLECL
QQRGYPLTIGVVCQASAHGNADALEFLMAQGVGLLDEEVALNATFHAAAEGGHLATVKVL
HAHGARIHVQNIAVAALAGHLRAVAWLVETLGAAVVLIPGVFARAAMSGNAELLAWLHQH
GCPWDASVFAAAAAFGSEEQLEWLAEHGCPIGLGGKLVQHHRHLGRAGFQSRSSVLLLLR
LDGMTDLQASAPAPEAARAPDAAALWHHLPPELLLRVLACLPPNERACTARLICKAAAAA
LSSPQHTTVRLSQPSPHSEFVRRWGGPGAMRPLILARRRMLLSLTAASGCLGSLQWLAAH
AGCSLTGEVFEAAAAAGRLDACRWLQQQGCYMRWALSGAEAATGAGQRATVEWLLANPGK
QDGTGLDGAACRTSLACSSARGGHVGLMDWLLQRHGLGHDGRAAANLLAAAAEGCDMPTL
QRLYHAYPPQADAGGGPVRLDPVVTSAAGSPTPDWKAKVEWLEGQGAAASSSHDACARAA
SRPDALDRLTWLRGRGYPWDKRVTEAAAVAGNLDALRYLLAEGCPVAEGTLGAAAWAGQL
ASLQALHAHSSTFIGWGLALARAASEGHLPVVAWVLEQQLVSIAYLQQCLPLLPEAATSG
SVELLAWLRNRGCPWGEGNFYCAAEAGSEEALEWLVAQGCPMQGPREWGDDPYVAAARQG
DWSTLACLHRLGCPWQPLNRDGGTFLNAVQAGCSVPALRRLLELGCPVGWRRAVEAAARR
GDEGLDGMTDVQASASVSQAAPAPTTAAPWHHLPPELLLRVLACLPPNELACTARLVCKA
TAIALSGPQHTTVRLSQPSPPGEFVRRWGSPGAMRPLTLVRRRLLLSLTAASGCLENLQW
LAAHVGCSLTGEVFEAAAAAGRLDVCRWLHQQDCDGQEWVLGGARAAAGAGQRAVVEWLL
ANPGKQDGTDLDGAASHTSLACSAAGGGHVGLMDWLLQRHGLERGRRAAATLLEAAAEGC
DLPTLQRLYHTYSSLVAAGGWSGRLGSVLNSAARSPTPDWKAKVEWLEGQGAAANPSHGA
CAWAASRPDALNRLTWLRGRGYPWDWQATNSAAAAGNLDALRYLLAEGCPVQGDTLVPAA
RAGQLASLQTLHAHNSIFTVWDFAFVCAARGGHMPVVAWLLEQQLVSIAYLQQCHYLLSE
AAQSGSVELMAWLRDRGCLWREDNFFCAAETGSEEALEWLVAQGCPMPGPGGRDDDPYLT
AAREGDWGMLACLRRLGCPWRPLDREGGTFVTAVAQGCSVPTLRRLLELGCPVDLRSAIE
AGAIEAAAVGDNTAADDAAAVWHHLPPELLPHILRCLPPNELVCVARLVCKATAAALSSP
QHTTISMSRPSPPAEFVRRWGGPGAMRPLTLVRRRQLLTLTAASGCLENLQWLEAHVGCS
LTREVFQAAAAAGRLDVCRWLQQQGCYGQGWALSGATAAAGAGQQATVEWLLANARDSCG
RTCLNPAACRTLAFSAARGGHVGLMDRLLQRQRLGRDVGAAATLLVAAAEGCDLPTLQRL
YHTYPPVAAGGGPGLRGPVLTSAAGSPTPDWKAKVEWLEGQGADASPSYDACAKAASRPD
ALGRLTWLRGRGYSWSWQAAKAAAVAGNLDALRYLLADGCRVEARTGGPEAGAGQLAALQ
TLHARSSTFTLLLKSTLVGAVQGGHLPVVAWLLEQQLVSLQQCLPLLPEAAGSGSVELLA
WLRDRGSPWGEDSFHCAAGAGNQEALEWLVAQGCPMQEPDGHGGDPYLRPGLRGDWSTLA
CLRRLGCPWRPLNREGGTFLNAVQAGCSVPALRRLLDLGCPLEWQSAIEAAARRGDEGLD
GMTDLQASAPAPEAAPAPGAAALWHRLPPELLLRVLACLPPNERACTARRVCKATAAALS
SPQHTTVRLSQPSPHGEFVRRWGRPGAMRSLTLVRRRLLLSLTAASGCLENLQWLAAHVG
CSPTREVFEAAAAAGRLDACRWLQQQGCYMQWWALSGAEAAAGAGQRATVEWLLACAQDS
GHKEDDLNSVADSTSLACSAARGGHVGTMDWLLQRRGLERDGDAAATVLVAAAEGCDLPT
LQRLYHAYPQAAAGGWPARLGTVLTSAAGSPTPDWKAKVEWLEGLGAAARSSPEACAKAA
SRPDALDRLTWLRGRGYPWDWRATDAVAVAGNLDALRYLLAEGCPVQESTGWAVAEARQL
ASLQALHAHSNTFTRWNSALAGAVRGGHLPVVAWLLEQQLVSLRQCPSLLCKAAKSGSVE
LLAWLRDRGCPWGDDSFHCAVGAGSEEALEWLVAQGCPMPVGGQVAAWFGWSACCRAGLH
EPRGPDDDLYLKPACNEDWNTLACLRRLGCPWLLLNREGGTFVNALLELGCPVDWRRAIE
EAEYGNEGVRAWLQQEQCRRGRGAGPQWRRAARCGAAGLLYARPALAAGAGLPAKVEWLE
GLGAAASSALNACTRAASRPDALDRLTWLRGRGYPWDWQATNSAAVAGNLNALRYLLVEG
CPSAVSTLGAAAGAGQLASLRALHAHSGNFTLTIFALARTVRGGHLPVVAWLLEQQLVSL
QQCPSLLCEAAASGSMELLAWLRDRGCPWGEDTIYGAAGAGSEEALEWLVAQGCPVTVGG
QVAAWLRLVWALVISRLEPRGPDDDPYLMAAVQGDWATLACLRRLGWPWGLLTRGGGTFA
NAVANGCSVPALRRLLELGCPVEWRSAIETAVAIEDKDVLSWLEEEQRRRCRGDGPQR
Download sequence
Identical sequences A0A2J7ZRH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]