SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7ZSN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7ZSN3
Domain Number 1 Region: 967-1039,1165-1339
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000522
Family Ankyrin repeat 0.0082
Further Details:      
 
Domain Number 2 Region: 132-175,295-456
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000596
Family Ankyrin repeat 0.005
Further Details:      
 
Domain Number 3 Region: 656-683,711-765
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000785
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J7ZSN3
Sequence length 1415
Comment (tr|A0A2J7ZSN3|A0A2J7ZSN3_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:PNH03279.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_010668 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MFRLLQRCLLRPPNAHKEASGAAAGDSGAPADPQGPAPPGVEQQQEPPAEPGAPQPTPHP
QDEGSHTAPDRSHKCWLPELVLRFAGFLTCNEVACILRLINKATAAQFGRPQDRTVRLSL
PGHVLEQEVFDAAAAAGQLEVCRLLWQQGCCYGPNLLHHAAAGGHGAVYEWCLETIPGCA
DHHTAGDAARAGNVTLMDWLLLAEPSPDVPKLLAGAASGCDLLTLQQLHHEYIESGCWGE
QLERWYHNRAPVLAAAAGSPTADWRRKVEWLEEWSFPRSAAACVEAARLPDGLARLQWLR
PRGYPLSAEVASAAACSGNVEALQFVLAAGVALDDEAAQGVVEGAAVAGHLAVLRALPQT
PGVLRSFLAHAAPAAAENGRLPVLEWLVETLGAAQVLQVRDIQSYKSAEVFDAAAAAGQL
EVCRLLWQQGCCYGPNLLHHAAAGGHGAVYEWCLETIPGCADHHTAGDAARAGNVTLMDW
LLLAEPSPDVPKLLAGAASGCDLLTLQQLHHEYIESGCWGEQLERWYHNRAPVLAAAAGS
PTADWRRKVEWLEEWSFPRSAAACVEAARLPDGLARLQWLRPRGYPLSAEVASAAACSGN
VEALQFVLAAGVALDDEAAQGVVEGAAVAGHLAVLRALPQTPGVLRSFLAHAAPAAAENG
RLPVLEWLVETLGAAQVLQVRDIQSYKSAVRSGSMVLLAWLHAHGCPCDASAFAAAAEWG
SEEQLEWLAARGCPMGAEGEAYMRAAAHGDLSMLRCLRRLGCPWGRHTHTFTLAIRTSPL
PALWWMLEEGCPVDWDAAVREAQASGRPEGKRAQKHHQQQLQQQEGEGRKRVRTDSGPMF
RLLQRLWRPPNAHKEALSAAAGDSGPTAADPHGPAPPGVGQQQGPPGMPELVLRFAGLLT
CNEVACILRLVNKATAAQFGRPQDRTVRLSLPVPHHAFVWRWGGARAMHSLTRSRRRQLA
CLTARSGSIANLELLLARGAKGHVLDQEVFDAAAAAGQLEVCRFLWQQGCCYGPNLLHHA
AAGGHGAVYEWCLETIPGCADHHTASDAARAGNVALMDWLLGADPSPDVPKLLAGAASGC
DLPTLQRLHHQDIESGCWGEQPEQQFHNRASVLAAAAGSPTADWRLKVEWLEKRGYPRSA
AACVEAARLPDGLARLQWLRPRHYPLSAKVVSAAASSGNVETLQFVLAAGVAMNDEVAQG
VVEGAAAAGHLAVLRALPQTRGARKSFLAHAAPAAAENGRLPVLEWLVETLGAAQVLQAR
GLQPYKSAIRSGSMELLAWLHAHGCPLDASAFAAAAEWGSEEQLEWLAARGCPMGAQGEA
YTWAVAHGDLSMLRCLRRLGCPWGHHAHTFTLAIRSFGPRPRFGASSTSPLPALWWMLEG
CPVDWDAAVREAQASGRPEVLAWMEEERQQREPRG
Download sequence
Identical sequences A0A2J7ZSN3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]