SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7ZY72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7ZY72
Domain Number 1 Region: 139-238
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000536
Family Pseudo ankyrin repeat 0.031
Further Details:      
 
Domain Number 2 Region: 338-517
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000176
Family Ankyrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J7ZY72
Sequence length 582
Comment (tr|A0A2J7ZY72|A0A2J7ZY72_9CHLO) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:PNH05221.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_008539 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MTQPRLQKPPSSQQQQEQQEQPDSVPAVGNDDPSRVWLPEVVHQFAGFLSGNELACTLRR
VNKATAAQFRAPEHTTVRLQLPVPHHAFAWRWGGGSATRSLTVRQRRQLPCLAARSGSIA
NLEVLLARGDLTSPSEVEVMEAAAAAGQLEVCRWLRQQGVPVTQDVLEAAAEAGQLEVCE
WLLAEGCRLTADLVWLAAGGDHRAVCEWLIAQDCPVNMRAAAAAARFGHVGLMDWLLART
PGDPVPDVWRLLEAAAAGCDLPTLQRLHRTYLDNRDGELVFNEQAWVAAAAGSPTVDWRA
KVAWLEGRGDNSRSESACKEAAQRVDGRDRLEWLEARGYPISYFVAYWAAGQGNTDALEL
LLARGVQPDVALADAAAHLAALGGHLAALKVLHAQGTHIDLGPVAAAAASGGHLPVVSWL
VEVLGSATTLEASLYTVAARSDNGTELWASLRDAGCPWNESVFGAAAYLGSEEQLEWLVE
RGCPMGDGCAPYLRALENADVAMLHCLRRLGCPWGQVGITFWCAIEACCTKTRSLRKQLL
LALPWLVEQGCPVDWDAVVWRAEMEGSSEVLAWVRQLRPQSV
Download sequence
Identical sequences A0A2J7ZY72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]