SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8A0E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8A0E5
Domain Number 1 Region: 947-1127
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000158
Family Ankyrin repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 191-238,362-521
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000817
Family Ankyrin repeat 0.0079
Further Details:      
 
Domain Number 3 Region: 768-829,939-983
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000327
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8A0E5
Sequence length 1212
Comment (tr|A0A2J8A0E5|A0A2J8A0E5_9CHLO) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:PNH05989.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_007699 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MITIKREKTERVSLCWACARTSARPRAHQPQAFQHRGRKDATAHPARSGGTGSMEQPRAP
PAEAASPPPAPQPPAEHELTADAADPFCVLPPELVQRFVGLVPPNEAACVLRLVSKAAAK
QLCRPQDRTVRLSLPVPHPAFVRRWGGADAFRSLNRAQRRQLTRLTARSGSIPNLEVLLA
RSDAVYVTEEGVLTAAVASGQLDACRWLRQQGCRFSWDVLTHAAKGGHQPVCEWLFAVGN
PLIVEGAAGDAARGGHVGLVDWLLGPAGLSCRDSFCSPDIPDLLAGVAAGCDLPTLKRLH
HAYLSSVGRALPDHPTKSVTAYAAGSPTADWAAKVEWLEERGYRRTAGACKRAAKLPDGL
ARLQWLRQRGYGLTPEVAVAAAKGGNVDVLRLVLAEGVKVGKEAAEEAIQRAACAGHAAF
LRALLHGRACKPENLRGAALAAANAGHLSVLEFLVEVLDAADVLSEGVLKAAVRSGSMEL
LAWLHGRGCPLDASMFAVAAECGSEEQLEWLVARGCPMGEEGEPYYRAAIFANTAVLGGL
RRLGCPWGPRTFVRAVTSYAAGCGYSREALRWLLEVGCPVPCWQEVLRAARPQDRPELAA
WLAEQMQLRGPQLGLGWLLELGCLVNWDEDMRKTEHKLPGEATPPFTPQQQQVADALPTA
DAADPSRIWLPELVQRFAGCLTCNEVACVLRLVNKAAAAQFSRPQERTIRLSLPVPHPEF
ARRWGGMDAFRSLNRAQRHQLPCLTARSGSIANLEVLLARGDTGHVLEGPALDAAAAGGQ
LEVCRWLRQQGCPYSTCGSTLCIASRGGQQAVCEWLLADVCPQNPWAAVQAACGGHVGLM
DWLLAAWADRSADNAELLQQWLFCLLAGAARGCDLPTLQRLHHAYLDSVGEVLSDEERMA
YVVSSAAASPAADWRAKVEWLEGRGYCRTAAACEQAAKQPDGLARLQWLRQRGYPLDSTL
IEHAGHAGNTDLLDFLLEEGVEMDQDRRRWAANAAACMGHVSFLRALLYEHGCQAADLRG
PTAAAARAGRLPVLEFLVEALGAADVLTVGVFKTATQSGSVELLGWLHAHGCPWDQSVFS
AAAELGSEEVVEWLAKRGCPMGERGTPYLRALCNGDLSMLRCLRRLGCPWGPRGRVFTRA
VGGFGAHCVELEPHAGPIPASTVAAQRTALRWLLEQGCPVVWGEALRMVQMQERYDLLAW
FVEQRRQRRSHA
Download sequence
Identical sequences A0A2J8A0E5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]