SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8A5I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8A5I5
Domain Number 1 Region: 324-526,981-1072
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000323
Family Ankyrin repeat 0.0082
Further Details:      
 
Domain Number 2 Region: 1254-1294,1433-1457,1553-1621,2053-2111
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000258
Family Ankyrin repeat 0.0088
Further Details:      
 
Domain Number 3 Region: 1978-2177
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000539
Family Ankyrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 739-1070
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000134
Family Ankyrin repeat 0.0056
Further Details:      
 
Domain Number 5 Region: 1442-1493,1521-1570
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000458
Family Pseudo ankyrin repeat 0.027
Further Details:      
 
Domain Number 6 Region: 1221-1363
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000133
Family Ankyrin repeat 0.0045
Further Details:      
 
Domain Number 7 Region: 627-672
Classification Level Classification E-value
Superfamily F-box domain 0.0000183
Family F-box domain 0.0061
Further Details:      
 
Domain Number 8 Region: 1145-1189
Classification Level Classification E-value
Superfamily F-box domain 0.0000235
Family F-box domain 0.0063
Further Details:      
 
Domain Number 9 Region: 98-155
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000549
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8A5I5
Sequence length 2275
Comment (tr|A0A2J8A5I5|A0A2J8A5I5_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:PNH07770.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_005745 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MTDLHASASASQAAPAADAAAPWQDLPPELIPHVLACLPPNERACTARLVSKGATPLYSG
PQQTIVRLSQPSPHNEFVRRWGGPGAMRPLTLTRRRLLLLLTAASGCLENLEWLAAHVGC
SLTGEAFGAAAAAGRLEVCRWLQQQGCYRQGWALSGAKAAAGEGQRATVEWILDNGRDSG
RTDLDSVEHRTSLACSAARGGHVGLMDWLLPRHVLERDGGAAATLFVAAAEGCDLPILQR
LYHTYPHADHGGWPSRLGYVLTSAAGSPTPDWKAKVQWLEGLGAAASPSYDACTKAASRP
DALDRLTWLRGRGYPWDWSVTEAAAVAGNLDALRYLLAEGCPVAVSTGGPVADAGQLAAL
QALYAHSRNFTLRDPALACAARGGHLPVVVWWLDQELVIPGQLLNLRREAAASGSVELLA
WLRGHGWPWDEDSFHCAAGAGREEALEWLVAQGCPMQGPNGRGGDPYLMAARQEDWGTLA
CLRRLGCPWRPLDWGAGTFADAVERGCSVPTLRQLLELGCPVDWRCAVEAAVAYRDEGVQ
VWLEEEQRQRDWDAPEAAPASDAAALWQHLPPELLLRVLACLPPNERACTARLVCKTAAA
ALSSPQHTTVRLSQPSXAPAPEAAPASDAAALWQHLPPELLLRVLACLPPNERACTARLV
CKTAAAALSSPQHTTVRLSQPSPCGEFVCRWGGPGAMRPLTLARRRLLLSLTAASGCLEN
LEWLAAHVGCFLTGGVFEAAAAAGRLDVCRWLQQQGCCDRRRSALRGAMAAAGAGQRSMV
EWILANARDSGRSDLDGLDCRTSLACSAARGGHVGLMVWLLQRHERLGRGARTAGAVGVV
LVAAAEGFDLPTLQRLYHAYPRDTAGGWNGRLGFALTSAAGSPTPDWKAKVKWLEGLGAA
ASSSHDACTKAASCPDALDRLTWLRGRGYPWNWQATEAAAVVGNLDALRYLLAEGCPLVD
FTWGAVARAGQLAALQALLAHSSTFTVASARPSLLLEAAESGNMELLAWLRDRGSLWGED
NFRYAATGGSEEALEWLVAQGCPVQGPDGQGDDPYLTAARQGDWGTLACLRRLGCPWRPL
NRGAGTFSGAVGRGCSVPALHRLLELGCPVDWRRAIKVAKCRDEARQISDLHASAPAPEA
APASDAAALWHHLPPELLLRVLACLPPNERACTARLVCKTAAAALSSPQHTTVRLSQPSP
HGEFVRRLGGPGVMHPLTLVRRRLLLSLTAASGCLENLQWLAESAGCSLSIKAMEAAAAA
GQVEVCRWLQQQGCGVGFGALEAAAGAGQRAMVEWLLANARDSGRSELDGLDCRTSLACS
AARGGHVGLMVWLLQRHELERDRRAAATLLVAAAEGCDLPTLQRLCHICPQVAFGLERVL
TSAAGSPTPDWKAKVEWLEGLGAATSPSHDACTKAASRPDALDRLTWLRGRGYQWDWSVT
EAAAVAGNLNALRYLLAEGCPLAVSTGEAAARAGQLASLQALHAHSGNFTPTDLPLARAV
RGEHLPVVAWWLKQQLVSLRQLPYLLREAAASGSMELLAWLRSCGCPWGEDTIYFAAGAG
SEETLEWLVAQRCPMPGPDGQGGDPYLMAACEGDWGTLACLRRLGCPWQPLDREGGTFSG
AVGRGCSVPALHRLLELGCPVDWRSAIKVAKCRDEARQMTDLQASASVSQAAPAPGAAAL
WHQLPPELLLRDLACLPPNERACTARLVCKAAAAALSSPQHTTVRLSEPSPHSEFARRWG
GPGAMRPLTLVRRRLLLSLTAASGCLENLQWLAAHVGCSLTGEVFEAAAAAGRLDVCRWL
QQQGCYGQGWALSGAKAAAGAGQRALVDWILANARDPGCTDLDGVKHSTSLACSAARGGH
VGLMDWLLQRHELERDRRAAATLLVAAAAEGCDLPTLQRLCHIYPQVAFGLGRVLTSAAG
SPTADWTSKVEWLEGQGAAASPSYDACTRAASRPDALDRLTWLRGRGYRWDWPVTEAAAV
AGNLDALRYLLAEGCPLVDSTGVAAARAGQLASLQALHAHSGSSTLRDLALACAARGGHL
PVVAWWLERRLVGIARLRQFPTLLLEAAKSGSVELLAWLRDRGCLWDEDSFHCAAWAGCE
AALEWLVAQGCPVPGPYGHRDDPYLTAALKEDWSTLACLRRLGCPWQPLDWEGGTFSGAV
GQGCSVPALHRLLELGCPVDWRRTIEACREERGPDGRGGDPYLTAAREEDWGTLACLRRL
GFPWRPLNRGAGTFAEVVRQGCSVPALRQLLELGCPVDWQSAIKVAERWDEGVRA
Download sequence
Identical sequences A0A2J8A5I5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]