SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8A615 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8A615
Domain Number 1 Region: 133-217,340-408
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000656
Family Ankyrin repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 413-492
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000128
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8A615
Sequence length 551
Comment (tr|A0A2J8A615|A0A2J8A615_9CHLO) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:PNH07972.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_005503 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MEPQRASKRQRTGSPLTLPSPPQHAAAAAPSDPSRVWLPEFVQRFAASLPPNEVACILRL
VNKAAAAQYRGPQHATIRLSQPVPHREFAWRWAGPDAMRRLVRSQREALPRLTAGSGSIA
NLEVLLAREDVANPLNHATLHAAAAAGQMEVCVWLRERGCPVNVLVLAAAAGGGHRAVCD
WLLANGCSEGDMVEAAAAAAARAGHVGLMEWLLGGSVPHGRASLFLLIRSVAAVCDLPTL
QRLHHTYLDSRGEELVSWDPECCVIGAAIASPSADWQAKVEWLESRGYPRTTCGAWGWAA
CTPDALSRLTWLQQRGYPIESSAARRAAETGNVEALEGILGQGVALDNFAASAATSEAAR
RGNVAVMQVLHAHGALSGQSAVEAAAGGGHLHAVAWLVETLGADVALTVATFACAAAGRS
RELLVWLRERNCPWDEDCFRSAAGNGSEEQLEWLAEHGCPMPVDGLLYAWAAIDGQLGML
RCLRRLGCPWSPDGRTFACAVGWARGFEEQLGRALGWLLDEGCPVDWGEAEAIAVDEALK
QWLRAQQQQRT
Download sequence
Identical sequences A0A2J8A615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]