SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8ABS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8ABS0
Domain Number 1 Region: 326-488
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000313
Family Ankyrin repeat 0.0071
Further Details:      
 
Domain Number 2 Region: 141-218
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000549
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8ABS0
Sequence length 559
Comment (tr|A0A2J8ABS0|A0A2J8ABS0_9CHLO) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:PNH09956.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_003366 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MEQQRPQTRQQMQPQPPAQQQEQQQVRAAPDATEEGPSPVWLPEVVHLFAGFLGGNELAC
TLRLVNKATAAQFRGPEHTTTRLSVLVPHHAFAWRWGASDATRSLAVRQRKQLPCLTARS
GSTANLEVLLARDDLTSPLDGVVMEAAASAGRLEVCRWLQQQGCCPWGYGVLYAAAEAGH
KEVCEQLLEWDRLVSWRAAAAAAAARGGHVGLMDWLLTGTDEAEDPNDGLELLKAAAAGC
DLPTLQRRHHAYLDRWGEELPCAQQGLVVAAAAGSLTADWRDKVEWLEGRGYPRTDSICA
RAAERADGRDRLEWLQQRGYPLAPVAACSAARHGNVDALQFLLAQGVHLGWSDSCATYSA
AQFGHLAALKVLHAHGARIAPTAAEGAASGGHLPVVAWLVETLGAAVALTADVTVSAAKS
GSVELLAWLHQHGCPWSASVFVAAAGTGSEELLEWLVEHGCPMGDDGRPYQRALENTDLA
MLRCLRRLGCPWGPVGRVFTSAVLSFRLITPLRRKQHLLALTWLVEQGCPVDWAEAEREA
ERRGDGEVLAWLRQMRSQQ
Download sequence
Identical sequences A0A2J8ABS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]