SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8ADL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8ADL9
Domain Number 1 Region: 431-478,619-674
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000253
Family Ankyrin repeat 0.015
Further Details:      
 
Domain Number 2 Region: 373-455
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000405
Family Pseudo ankyrin repeat 0.0088
Further Details:      
 
Domain Number 3 Region: 596-677,770-888
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000231
Family Ankyrin repeat 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8ADL9
Sequence length 1018
Comment (tr|A0A2J8ADL9|A0A2J8ADL9_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:PNH10618.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_002643 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MPSNKGDGAVAASLHQRGCLESPSSLPVGGAASASPDPSHIWLPELVQRYARSLSCNEVA
CTLRLVNKATAAQFRGPQDRTVRLSLPVPHHAFVQRWRAMGALRGLTVIQREQLSWLTAC
SGSIANLEVLLAREDCACCLDALRAAAAGSVPLAPAAGLPLGLYGPQRSSGGGGHQDVCE
WLLASGCPWSDWAAGRAARGGHVGLMDWLLGTGHVSPSKGLVEDAAAGCDLPTLQRLHST
HFTQQLGEAFKERVMAAAAGSLTADWRAKVEWLEGQGFPRTAEACVQAVKQPNGRGRLEW
LQQRGYPLDGGVAVAAAEVGVVDALQYVLESGVALDQRTIGMAAREAARRGQLAVVQALH
ARAFDVAVAATAAAERGHLPVVAWLVEALGAANVLSAAVIRSAAVSGSMELLAWLVEALG
TEKVLLAKVFASAARSGNMELLAWLHDRGCPWDESVFAAAAEAGCEEQLEWLAARGCPMP
GAGAALASPDPSRIWLPELVQRYARSLSRNEVACALRLVNKATAAQFRGPQDRTVRLSLR
VPHHAFVQRWGGVGAMRSLTLSQRRQLPCLTARSGSITNLKVLLLGDNLSGVVDKDEVLA
VAAGAGQLKVCRWLCQYQRYPPDNGVIRALLAAARGGQQAVCEWLLDIGCPWGEEAPAEA
ARGGHVGLMDWLLGRDWLQGPEALVGKGLLAGTAAGCDLPTLQRLHQTHQLYDNISKEAV
MASAAGSLTADWHAKVEWLEGRGYPRTAKAFAEAVKQPDWRTRLKWLQQRGYPLNGYIAV
VAASVGAMDALQYVLELGVTLDERTALHARGFDIAGAATAAAGRGHLPVVAWLVETLGAN
KVLSAQLFASATRPGKIELLAWLHDRGCPLDKSVFVAAVEAGCEEQLEWLAARSCPMPED
GEAYARPACNDDLATLKCLLRLGCSLGPDGRAFTCALENIWYSRAGTTSNGRRDSAWWVA
AEAGLQHGLPWLLEQLGPHVDWDAVELMGRTASSEVDEDIKAWKSELLDRVYEMREAA
Download sequence
Identical sequences A0A2J8ADL9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]