SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8AED7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8AED7
Domain Number 1 Region: 53-129
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000366
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8AED7
Sequence length 213
Comment (tr|A0A2J8AED7|A0A2J8AED7_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:PNH10872.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_002393 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MNAPPPPGAVDTHPTNQARGAAAAAANGNLPVVAWLVEVLGAATALTAGVYADAASSGSA
ELLAWLHQHGCPWDASVLASAAREGSEEQLEWLVERGCPMGDDGELYVQGLVDADLPMLR
CLQRLGCPWGLIGRTFEAGVLACSSDRVLRALPWLVEQGCPVDWAAAEREAEESGDSKVL
AWRSSHNKRPSRAKTHMVEGGVLDPISGITLPI
Download sequence
Identical sequences A0A2J8AED7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]